PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS60538.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB_related
Protein Properties Length: 95aa    MW: 10859.3 Da    PI: 11.1955
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS60538.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.73.1e-142670347
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +WT+eE++ ++ + k+ G+g+W+ I++   k+Rt+ q+ s+ qky
       EPS60538.1 26 PWTEEEHKWFLLGLKKVGKGDWRGISKNYVKTRTPTQVASHAQKY 70
                     8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.6941975IPR017930Myb domain
SuperFamilySSF466891.31E-182076IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-172274IPR006447Myb domain, plants
SMARTSM007174.8E-102373IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-112570IPR009057Homeodomain-like
CDDcd001671.01E-92671No hitNo description
PfamPF002496.7E-122670IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 95 aa     Download sequence    Send to blast
GYASADDGVV VHLASAGIRE RKRGVPWTEE EHKWFLLGLK KVGKGDWRGI SKNYVKTRTP  60
TQVASHAQKY FLRQSNANRR RRRSSLFDIT TESVT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016169474.18e-44PREDICTED: LOW QUALITY PROTEIN: transcription factor MYB1R1-like
SwissprotQ2V9B04e-40MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLS8DCJ93e-65S8DCJ9_9LAMI; Uncharacterized protein (Fragment)
STRINGEFJ090682e-41(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA25742351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19000.24e-38MYB_related family protein
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]